TF Information

DREB1A *(Oryza indica)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	BGIOSGA029415	T000678_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB1A M09710_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1A_01	0.924	1.000
DREB1A M09711_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SED_Q2	0.924	1.000
Q8GZQ2_MAIZE M09720_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1A_02	0.706	0.792
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
BGIOSGA029415-PA	AP2	49	102	PVFRGVRRRGNAGRWVCEVRVPGRRGCRLWLGTFDTAEGAARAHDAAMLAINAG

Links
Other AP2 family TFs
Other *Oryza indica* TFs

Invalid Input OrderBy

34 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action