CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bra027615 *(Brassica rapa)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Bra027615	T001183_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G63040 M06590_2.00	Arabidopsis thaliana	TTGAAA	TTTCAA	Dap-seq OMalley et al.(2016) AT1G63040_col_a	0.741	0.980
ERF027 M06566_2.00	Arabidopsis thaliana	NNNNNNHNNHNYYRCCGACAN	NTGTCGGYRRNDNNDNNNNNN	Dap-seq OMalley et al.(2016) AT1G12630_col_a	0.704	0.878
ERF027 M06567_2.00	Arabidopsis thaliana	NNYYRCCGACANHNNN	NNNDNTGTCGGYRRNN	Dap-seq OMalley et al.(2016) AT1G12630_colamp_a	0.704	0.878
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra027615.1-P	AP2	85	135	PVYRGIRCRSGKWVSEIREPKKTTRVWLGTYSTPEMAAAAYDVAALALKGG

Links
Other AP2 family TFs
Other *Brassica rapa* TFs