TF Information

F775_08700 *(Aegilops tauschii)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	F775_08700	T001558_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LOC_Os08g36920 M01634_2.00	Oryza sativa	NNNGSCGHNN	NNDCGSCNNN	PBM Weirauch et al.(2014) pTH8596	0.687	0.880
A4F248_TOBAC M09725_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRAF1_01	0.686	0.820
A4F249_TOBAC M09726_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRAF2_01	0.686	0.820
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMT16504	AP2	124	175	TQYRGIRQRLWGKWAAEIRDPRRAVRVWLGTFDTAEDAARAYDRAAVEFRGP

Links
Other AP2 family TFs
Other *Aegilops tauschii* TFs

Invalid Input OrderBy

26 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action