TF Information

fgenesh2_kg.1__2503__AT1G22985.1 *(Arabidopsis lyrata)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	fgenesh2_kg.1__2503__AT1G22985.1	T001642_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF069 M01604_2.00	Arabidopsis thaliana	NNGCCGNNN	NNNCGGCNN	PBM Weirauch et al.(2014) pTH7550	0.788	0.887
CRF3 M01633_2.00	Arabidopsis thaliana	NNGCCRNNN	NNNYGGCNN	PBM Weirauch et al.(2014) pTH8110	0.754	0.736
CRF4 M01626_2.00	Arabidopsis thaliana	SCGCCGCC	GGCGGCGS	PBM Weirauch et al.(2014) pTH8261	0.735	0.698
CRF4 M06645_2.00	Arabidopsis thaliana	BMDCCGCCGCCRCHDHHDCYN	NRGHDDHDGYGGCGGCGGHKV	Dap-seq OMalley et al.(2016) CRF4_col_a	0.735	0.698
CRF4 M06646_2.00	Arabidopsis thaliana	YCDYCGCCGCCGYYD	HRRCGGCGGCGRHGR	Dap-seq OMalley et al.(2016) CRF4_colamp_a	0.735	0.698
CRF2 M01622_2.00	Arabidopsis thaliana	SCGCCGCC	GGCGGCGS	PBM Weirauch et al.(2014) pTH8680	0.732	0.698
O65242_TOBAC M09730_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TSI1_01	0.715	0.660
ERF2_TOBAC M09727_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF2_01	0.681	0.623
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
fgenesh2_kg.1__2503__AT1G22985.1	AP2	60	118	KKFRGVRQRPWGKWAAEIRCGRAHGGGKGRPERVWLGTFETAEEAALAYDNAAIQLIGP

Links
Other AP2 family TFs
Other *Arabidopsis lyrata* TFs

Invalid Input OrderBy

304 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action