TF Information

GLYMA06G45680 *(Glycine max)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	GLYMA06G45680	T001820_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.736	0.918
Q8H769_WHEAT M09721_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1_01	0.684	0.837
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.679	0.837
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA06G45680.1	AP2	65	116	CNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAISAALAYDEAARAMYGS

Links
Other AP2 family TFs
Other *Glycine max* TFs

Invalid Input OrderBy

104 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action