TF Information

OB01G16440 *(Oryza brachyantha)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	OB01G16440	T002976_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8LKX0_MAIZE M09722_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DBF2_01	0.710	0.760
ERF035 M06631_2.00	Arabidopsis thaliana	YCACCGACANWDNH	DNHWNTGTCGGTGR	Dap-seq OMalley et al.(2016) AT3G60490_col_a	0.682	0.760
ERF035 M06632_2.00	Arabidopsis thaliana	NNBCACCGACAHWNNN	NNNWDTGTCGGTGVNN	Dap-seq OMalley et al.(2016) AT3G60490_colamp_a	0.682	0.760
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OB01G16440.1	AP2	59	110	ASYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPCPEMAARAHDHAEPSTENE

Links
Other AP2 family TFs
Other *Oryza brachyantha* TFs

Invalid Input OrderBy

90 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action