TF Information

Solyc12g056430.1 *(Solanum lycopersicum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Solyc12g056430.1	T005556_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB1E M00963_2.00	Arabidopsis thaliana	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_thaliana	0.684	0.680
DREB1E M06589_2.00	Arabidopsis thaliana	NNNYYGYCGACATVD	HBATGTCGRCRRNNN	Dap-seq OMalley et al.(2016) DDF2_col_a	0.684	0.680
DREB1E M09702_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1E_03	0.684	0.680
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc12g056430.1.1	AP2	42	93	PVFRGVRKRDNDKWVCEIREPTKQKRIWLGTYLTAEMAARAHDVAALALKGE

Links
Other AP2 family TFs
Other *Solanum lycopersicum* TFs

Invalid Input OrderBy

45 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action