TF Information

Traes_1AL_A9FB6BF52 *(Triticum aestivum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Traes_1AL_A9FB6BF52	T005741_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.828	0.940
Q84ND8_HORVU M09719_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DRF11_01	0.732	0.940
Q84JE9_HORVU M09718_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DRF13_01	0.732	0.940
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.702	0.800
Q8H769_WHEAT M09721_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1_01	0.695	0.800
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_1AL_A9FB6BF52.1	AP2	136	187	CGFRGVRQRTWGKWVAEIREPNRVSRLWLGTFPTAEDAARAYDEAARAMYGA

Links
Other AP2 family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

119 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action