TF Information

Traes_4AL_1A0E673DC *(Triticum aestivum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Traes_4AL_1A0E673DC	T005827_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF094 M01602_2.00	Arabidopsis thaliana	VGCCGCCD	HGGCGGCB	PBM Weirauch et al.(2014) pTH8276	0.718	0.735
P93392_TOBAC M09731_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$OPBP1_01	0.697	0.755
Q5Y836_TOBAC M09732_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF5_02	0.695	0.837
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_4AL_1A0E673DC.1	AP2	99	151	SPLIGVRKRPWGKYAAEIRDSTRNGARVWLGTFDTPQAAALAYDQAAFSVRGP

Links
Other AP2 family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

284 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action