TF Information

Traes_5BL_199A847E4 *(Triticum aestivum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Traes_5BL_199A847E4	T005873_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8W236_WHEAT M09724_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF1_02	0.775	0.827
Q3T5M9_WHEAT M09716_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF2_02	0.721	0.769
Q8S4P8_HORVD M09723_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF2_03	0.688	0.750
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_5BL_199A847E4.1	AP2	40	93	PLYRGVRRRGRVGQWVCEVRVPGVKGSRLWLGTFTTAEMAARAHDAAVLALSGR

Links
Other AP2 family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

18 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action