TF Information

TRIUR3_29805 *(Triticum urartu)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	TRIUR3_29805	T006007_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q3T5M9_WHEAT M09716_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF2_02	0.892	1.000
Q8S4P8_HORVD M09723_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF2_03	0.731	0.759
Q8W236_WHEAT M09724_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF1_02	0.704	0.685
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
TRIUR3_29805-P1	AP2	48	103	PVYRGVRRRGREGQWVCELRVPAGSRSYSRIWLGTFASAQMAARAHDSAALALSGR

Links
Other AP2 family TFs
Other *Triticum urartu* TFs

Invalid Input OrderBy

16 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action