CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

VIT_06s0061g01390 *(Vitis vinifera)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	VIT_06s0061g01390	T006049_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB1B M06643_2.00	Arabidopsis thaliana	DHBRCCGACRHN	NDYGTCGGYVDH	Dap-seq OMalley et al.(2016) CBF1_col_a	0.708	0.860
DREB1B M06644_2.00	Arabidopsis thaliana	NNNHBRCCGACAWNN	NNWTGTCGGYVDNNN	Dap-seq OMalley et al.(2016) CBF1_colamp_a	0.708	0.860
DREB1D M06678_2.00	Arabidopsis thaliana	NHBRCCGACRTNN	NNAYGTCGGYVDN	Dap-seq OMalley et al.(2016) CBF4_col_a	0.694	0.880
DREB1D M06679_2.00	Arabidopsis thaliana	HYRCCGACATND	HNATGTCGGYRD	Dap-seq OMalley et al.(2016) CBF4_colamp_a	0.694	0.880
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
VIT_06s0061g01390.t01	AP2	52	103	PIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHDAAALALRGH

Links
Other AP2 family TFs
Other *Vitis vinifera* TFs