CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Carubv10017565m.g *(Capsella rubella)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Carubv10017565m.g	T007889_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF119 M01093_2.00	Arabidopsis thaliana	NNNGCCGNN	NNCGGCNNN	PBM Lambert et al.(2019) pTH11551	0.780	0.900
ERF118 M01047_2.00	Arabidopsis thaliana	NCGCCGYNN	NNRCGGCGN	PBM Sullivan et al.(2014) pTH7330	0.713	0.760
ERF118 M06591_2.00	Arabidopsis thaliana	YHDYCKCCGCCGYHD	HDRCGGCGGMGRHDR	Dap-seq OMalley et al.(2016) CRF10_col100_a	0.713	0.760
ERF118 M06592_2.00	Arabidopsis thaliana	NGDATCHNDGATTCNNH	DNNGAATCHNDGATHCN	Dap-seq OMalley et al.(2016) CRF10_colamp_a	0.713	0.760
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10017565m	AP2	129	179	TKPVGVRQRKWGKWAAEIRHPITKTRTWLGTYETLEQAANAYAAKKLEFDS

Links
Other AP2 family TFs
Other *Capsella rubella* TFs