TF Information

Eucgr.G01970 *(Eucalyptus grandis)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Eucgr.G01970	T008190_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF115 M06657_2.00	Arabidopsis thaliana	CCGCCGYMRYHDCCR	YGGHDRYKRCGGCGG	Dap-seq OMalley et al.(2016) ERF115_col_a	0.780	0.878
ERF115 M06658_2.00	Arabidopsis thaliana	CKCCGCCGYMRYHDY	RHDRYKRCGGCGGMG	Dap-seq OMalley et al.(2016) ERF115_colamp_a	0.780	0.878
RAP2-6 M00717_2.00	Arabidopsis thaliana	NBGCYGNH	DNCRGCVN	PBM Chang et al.(2013) pTH7225	0.742	0.796
RAP2-6 M00841_2.00	Arabidopsis thaliana	NGCCGHHNNN	NNNDDCGGCN	PBM Franco-Zorrilla et al.(2014) RAP2.6	0.742	0.796
RAP2-6 M06579_2.00	Arabidopsis thaliana	HHDYCKCCGCCGYMD	HKRCGGCGGMGRHDD	Dap-seq OMalley et al.(2016) RAP26_col_a	0.742	0.796
RAP2-6 M06580_2.00	Arabidopsis thaliana	CGCCGY	RCGGCG	Dap-seq OMalley et al.(2016) RAP26_colamp_a	0.742	0.796
ERF113 M01629_2.00	Arabidopsis thaliana	NNGCCGHHNN	NNDDCGGCNN	PBM Weirauch et al.(2014) pTH8097	0.726	0.898
A5JTT1_WHEAT M09700_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF3_01	0.712	0.755
ERF2_TOBAC M09727_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF2_01	0.693	0.776
AT2G33710 M01613_2.00	Arabidopsis thaliana	NSMGCCGHMN	NKDCGGCKSN	PBM Weirauch et al.(2014) pTH7543	0.692	0.816
AT2G33710 M06606_2.00	Arabidopsis thaliana	DBCGCCGCCGYHDHHDNH	DNHDDHDRCGGCGGCGVH	Dap-seq OMalley et al.(2016) At2g33710_colamp_a	0.692	0.816
AT2G33710 M06607_2.00	Arabidopsis thaliana	NHDYCKCCGCCGYMD	HKRCGGCGGMGRHDN	Dap-seq OMalley et al.(2016) At2g33710_col	0.692	0.816
ERF1A M00848_2.00	Arabidopsis thaliana	NNNNRNN	NNYNNNN	PBM Franco-Zorrilla et al.(2014) ATERF1	0.685	0.776
ERF1A M00720_2.00	Arabidopsis thaliana	NMGCCRNCN	NGNYGGCKN	PBM Chang et al.(2013) pTH7202	0.685	0.776
ERF2 M01631_2.00	Arabidopsis thaliana	NNNGCCGNCN	NGNCGGCNNN	PBM Weirauch et al.(2014) pTH8113	0.685	0.776
ERF2 M06672_2.00	Arabidopsis thaliana	HHNHHNYHDYCGCCGCCRYND	HNRYGGCGGCGRHDRNDDNDD	Dap-seq OMalley et al.(2016) ERF2_col_a	0.685	0.776
ERF2 M06673_2.00	Arabidopsis thaliana	NNNNNNNHNNHDSMGCCGCCR	YGGCGGCKSHDNNDNNNNNNN	Dap-seq OMalley et al.(2016) ERF2_colamp_a	0.685	0.776
ERF094 M01602_2.00	Arabidopsis thaliana	VGCCGCCD	HGGCGGCB	PBM Weirauch et al.(2014) pTH8276	0.683	0.755
ERF5 M00721_2.00	Arabidopsis thaliana	NNNGSMRNMN	NKNYKSCNNN	PBM Chang et al.(2013) pTH7197	0.677	0.735
ERF5 M06674_2.00	Arabidopsis thaliana	YCDYCKCCGCCGYCD	HGRCGGCGGMGRHGR	Dap-seq OMalley et al.(2016) ERF5_col_a	0.677	0.735
ERF5 M06675_2.00	Arabidopsis thaliana	NHDBCGCCGCCRYHDNHDNNN	NNNHDNHDRYGGCGGCGVHDN	Dap-seq OMalley et al.(2016) ERF5_colamp_a	0.677	0.735
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.G01970.1	AP2	53	104	RHYRGVRQRPWGKWAAEIRDPIKAARVWLGTFDTAEAAALAYDTAALRFKGT
Eucgr.G01970.2	AP2	4	55	RHYRGVRQRPWGKWAAEIRDPIKAARVWLGTFDTAEAAALAYDTAALRFKGT

Links
Other AP2 family TFs
Other *Eucalyptus grandis* TFs

Invalid Input OrderBy

598 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Eucgr.G01970 (Eucalyptus grandis) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

598 Related TFs

Invalid Input OrderBy

Eucgr.G01970 **(Eucalyptus grandis)
AP2**