TF Information

gene20607-v1.0-hybrid *(Fragaria vesca)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	gene20607-v1.0-hybrid	T008413_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PLT1 M06622_2.00	Arabidopsis thaliana	DDCACGNWWHYCRAGRHNN	NNDYCTYGRDWWNCGTGHH	Dap-seq OMalley et al.(2016) PLT1_col_a	0.883	0.865
PLT1 M06623_2.00	Arabidopsis thaliana	DYDCRNWTYYCRAG	CTYGRRAWNYGHRH	Dap-seq OMalley et al.(2016) PLT1_colamp_a	0.883	0.865
Q6SA75_TOBAC M09733_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ANTL_01	0.852	0.846
Q6SA75_TOBAC M09734_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ANTL_02	0.852	0.846
ANT M02647_2.00	Arabidopsis thaliana	DNRCACRNWTCCCVADGYNHW	WDNRCHTBGGGAWNYGTGYNH	SELEX Mathelier et al.(2014) MA0571.1	0.838	0.827
ANT M09705_2.00	Arabidopsis thaliana	CACRNWTCCCRAKG	CMTYGGGAWNYGTG	Transfac Matys et al.(2006) P$ANT_01	0.838	0.827
AIL7 M06688_2.00	Arabidopsis thaliana	CRNWTHYCRAG	CTYGRDAWNYG	Dap-seq OMalley et al.(2016) AIL7_col_a	0.824	0.837
AIL7 M06689_2.00	Arabidopsis thaliana	DCRNWTHYCRAG	CTYGRDAWNYGH	Dap-seq OMalley et al.(2016) AIL7_colamp_a	0.824	0.837
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
mrna20607.1-v1.0-hybrid	AP2	171	228	SIYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQGGYDKEEKAARAYDLAALKYWGT
mrna20607.1-v1.0-hybrid	AP2	270	322	SMYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFSTEEEAAEAYDIAAIKFRGL

Links
Other AP2 family TFs
Other *Fragaria vesca* TFs

Invalid Input OrderBy

526 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action