TF Information

orange1.1g020801m.g *(Citrus sinensis)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	orange1.1g020801m.g	T009221_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ABR1 M01051_2.00	Arabidopsis thaliana	NYGSCGSCVNN	NNBGSCGSCRN	PBM Sullivan et al.(2014) pTH7383	0.720	0.941
ABR1 M06684_2.00	Arabidopsis thaliana	CKCCGCCGYMDHHNYHNHH	DDNDRNDDHKRCGGCGGMG	Dap-seq OMalley et al.(2016) ABR1_col_a	0.720	0.941
ABR1 M06685_2.00	Arabidopsis thaliana	HNNHDSCGCCGCMAWHNNNNN	NNNNNDWTKGCGGCGSHDNND	Dap-seq OMalley et al.(2016) ABR1_colamp_a	0.720	0.941
A4F249_TOBAC M09726_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRAF2_01	0.701	0.765
A4F248_TOBAC M09725_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRAF1_01	0.701	0.765
ERF11 M01606_2.00	Arabidopsis thaliana	NHGCCGNHNN	NNDNCGGCDN	PBM Weirauch et al.(2014) pTH8117	0.677	0.765
ERF11 M06575_2.00	Arabidopsis thaliana	NHNNHDSCGCCGYCRHHNNN	NNNDDYGRCGGCGSHDNNDN	Dap-seq OMalley et al.(2016) ERF11_colamp_a	0.677	0.765
ERF11 M06576_2.00	Arabidopsis thaliana	NHNYCKCCGCCGYHD	HDRCGGCGGMGRNDN	Dap-seq OMalley et al.(2016) ERF11_col_b	0.677	0.765
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
orange1.1g020801m	AP2	134	185	RRYRGVRHRPWGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGN
orange1.1g020922m	AP2	133	184	RRYRGVRHRPWGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGN

Links
Other AP2 family TFs
Other *Citrus sinensis* TFs

Invalid Input OrderBy

223 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action