TF Information

Pavir.Ba03491 *(Panicum virgatum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Pavir.Ba03491	T009370_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF094 M01602_2.00	Arabidopsis thaliana	VGCCGCCD	HGGCGGCB	PBM Weirauch et al.(2014) pTH8276	0.717	0.745
Q5Y836_TOBAC M09732_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF5_02	0.713	0.894
P93392_TOBAC M09731_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$OPBP1_01	0.705	0.787
ERF096 M01630_2.00	Arabidopsis thaliana	NVGCCGNCNN	NNGNCGGCBN	PBM Weirauch et al.(2014) pTH7909	0.685	0.809
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pavir.Ba03491.1.p	AP2	153	203	LIGVRKRPWGKYAAEIRDSTRNGERVWIGTFDTPEAAALAYDQAAYSMRGP

Links
Other AP2 family TFs
Other *Panicum virgatum* TFs

Invalid Input OrderBy

318 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action