TF Information

Pavir.Fb02246 *(Panicum virgatum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Pavir.Fb02246	T009457_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8GZQ2_MAIZE M09720_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1A_02	0.724	0.808
DREB1A M09710_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1A_01	0.692	0.769
DREB1A M09711_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SED_Q2	0.692	0.769
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pavir.Fb02246.1.p	AP2	46	101	PVFRGVRRSGRAGGRCRWVCEVRVPGRRGCRLWLGTYGAAEAAARAHDAAARRLND

Links
Other AP2 family TFs
Other *Panicum virgatum* TFs

Invalid Input OrderBy

33 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action