TF Information

Pavir.Ia01229 *(Panicum virgatum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Pavir.Ia01229	T009501_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q2TN80_WHEAT M09715_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF1_02	0.718	0.920
EREBP1 M09708_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$EREBP1_01	0.702	0.960
Q7Y1W2_TOBAC M09735_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CEF1_01	0.677	0.880
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pavir.Ia01229.1.p	AP2	23	74	NQFRGIRRRPWGKWPAEIRDPRKGVRVWLGTFNSSEEAARAYDAEARRIRGK

Links
Other AP2 family TFs
Other *Panicum virgatum* TFs

Invalid Input OrderBy

73 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action