CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Q8W242_BRANA *(Brassica napus)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Q8W242_BRANA	T010130_2.00	Misc (2018-Jan-19)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8W242_BRANA M09747_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF_01	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8S2T2_BRANA M09744_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF17_01	0.802	1.000
A6N8P3_BRANA M09738_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBI5_01	0.802	1.000
Q8S2T3_BRANA M09745_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF16_01	0.707	0.900
Q6T3U0_BRANA M09743_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBII1_01	0.707	0.900
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Q8W242_BRANA	AP2	47	98	PIYRGVRLRKSGKWVCEVREPNKKSRIWLGTFKTAEIAARAHDVAALALRGR

Links
Other AP2 family TFs
Other *Brassica napus* TFs