TF Information

GRMZM2G702026 *(Zea mays)* B3
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02362 (B3)	IPR003340	GRMZM2G702026	T019447_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ARF2 M06714_2.00	Arabidopsis thaliana	NHTGTCKSHD	HDSMGACADN	Dap-seq OMalley et al.(2016) ARF2_col_v31	0.863	0.863
ARF3 M00852_2.00	Arabidopsis thaliana	NKGTYBNN	NNVRACMN	PBM Franco-Zorrilla et al.(2014) ETTIN	0.726	0.726
ARF5 M06701_2.00	Arabidopsis thaliana	WYTTGTCGGN	NCCGACAARW	Dap-seq OMalley et al.(2016) MP_col	0.705	0.705
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G702026_P01	B3	122	223	FCKTLTASDTSTHGGFSVLRRHAEECLPQLDMTQNPPWQELVAKDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRL

Links
Other B3 family TFs
Other *Zea mays* TFs

Invalid Input OrderBy

574 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action