TF Information

Thhalv10005481m.g *(Eutrema salsugineum)* B3
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02362 (B3)	IPR003340	Thhalv10005481m.g	T024220_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FUS3 M06706_2.00	Arabidopsis thaliana	WNHWTGCATGYDHDW	WHDHRCATGCAWDNW	Dap-seq OMalley et al.(2016) FUS3_col_a	0.949	0.949
FUS3 M09773_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FUS3_Q2	0.949	0.949
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10005481m	B3	103	205	FQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIRMEDLDGLHVWTFKYRFWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQNFHSNTYVIQARKAS

Links
Other B3 family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

27 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action