TF Information

AMTR_s00019p00254380 *(Amborella trichopoda)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	AMTR_s00019p00254380	T030489_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AMS M09782_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AMS_01	0.871	0.653
SCRM M09784_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ICE1_01	0.860	0.694
DYT1 M02654_2.00	Arabidopsis thaliana	TCACGTGWYTBRYK	MRYVARWCACGTGA	SELEX Mathelier et al.(2014) MA0580.1	0.845	0.551
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ERN07465	bHLH	79	127	TAKNIVSERVRRKKLNDRLYQLRSVVPIISKMDKASIIKDAIAYIQSLQ

Links
Other bHLH family TFs
Other *Amborella trichopoda* TFs

Invalid Input OrderBy

271 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action