CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

DYT1 *(Arabidopsis thaliana)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	AT4G21330	T030674_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Encodes a bHLH transcription factor strongly expressed in the tapetum from late anther stage 5 to early stage 6, and at a lower level in meiocytes. dyt1 mutant exhibits abnormal anther morphology beginning at anther stage 4. DYT1 acts downstream of SPL/NZZ and EMS1/EXS, and is required for normal expression of AMS, MS1 and other tapetum preferential genes.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DYT1 M02654_2.00	Arabidopsis thaliana	TCACGTGWYTBRYK	MRYVARWCACGTGA	SELEX Mathelier et al.(2014) MA0580.1	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT4G21330.1	bHLH	30	78	KSPNLEAERRRREKLHCRLMALRSHVPIVTNMTKASIVEDAITYIGELQ

Links
Other bHLH family TFs
Other *Arabidopsis thaliana* TFs