TF Information

Olig1 *(Rattus norvegicus)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ENSRNOG00000028648	T037238_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: This gene is a member of the oligodendrocyte lineage gene family which encode basic helix-loop-helix transcription factors. Studies in mice show that it is coexpressed with Olig2 in neural progenitors, and has a role in the development and maturation of oligodendrocytes. [provided by RefSeq, Jul 2008]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OLIG1 M02806_2.00	Homo sapiens	AMCATATGBT	AVCATATGKT	SELEX Jolma et al.(2013) OLIG1_1	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSRNOP00000002827	bHLH	80	139	LRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLG

Links
Other bHLH family TFs
Other *Rattus norvegicus* TFs

Invalid Input OrderBy

27 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action