TF Information

bHLH34 *(Arabidopsis lyrata)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	fgenesh2_kg.3__2536__AT3G23210.1	T039124_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BHLH34 M01704_2.00	Arabidopsis thaliana	VCACGYGH	DCRCGTGB	PBM Weirauch et al.(2014) pTH7212	0.914	0.980
BHLH34 M06734_2.00	Arabidopsis thaliana	NNNHNNDNNNNVCACGTGHCN	NGDCACGTGBNNNNHNNDNNN	Dap-seq OMalley et al.(2016) bHLH34_colamp_a	0.914	0.980
BHLH34 M06735_2.00	Arabidopsis thaliana	RWRNNNNNCACGTGBNNNNNNNN	NNNNNNNNVCACGTGNNNNNYWY	Dap-seq OMalley et al.(2016) bHLH34_col	0.914	0.980
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
fgenesh2_kg.3__2536__AT3G23210.1	bHLH	162	212	PGTKACREKLRREKLNDKFMDLSSVLEPGRTPKTDKSAILNDAIRVVNQLR

Links
Other bHLH family TFs
Other *Arabidopsis lyrata* TFs

Invalid Input OrderBy

17 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action