TF Information

GLYMA20G24170 *(Glycine max)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	GLYMA20G24170	T039771_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AMS M09782_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AMS_01	0.914	0.857
SCRM M09784_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ICE1_01	0.847	0.755
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA20G24170.2	bHLH	259	307	QSKNLVAERKRRKKLNDRLYNLRSLVPRISKLDRASILGDAIEYVKDLQ

Links
Other bHLH family TFs
Other *Glycine max* TFs

Invalid Input OrderBy

223 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action