TF Information

PGSC0003DMG400014246 *(Solanum tuberosum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	PGSC0003DMG400014246	T043458_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SCRM M09784_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ICE1_01	0.890	0.938
AMS M09782_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AMS_01	0.871	0.875
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PGSC0003DMT400036951	bHLH	358	405	AKNLMAERRRRKKLNDRLYMLRSVVPKITKMDRASILGDAIKYLKELQ

Links
Other bHLH family TFs
Other *Solanum tuberosum* TFs

Invalid Input OrderBy

283 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action