TF Information

PGSC0003DMG400022058 *(Solanum tuberosum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	PGSC0003DMG400022058	T043490_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BHLH80 M06722_2.00	Arabidopsis thaliana	DNCMACTTGCH	DGCAAGTKGNH	Dap-seq OMalley et al.(2016) bHLH80_col_a	0.857	0.843
BHLH80 M06723_2.00	Arabidopsis thaliana	DKCMACTTGCA	TGCAAGTKGMH	Dap-seq OMalley et al.(2016) bHLH80_colamp_a	0.857	0.843
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PGSC0003DMT400056716	bHLH	373	423	ATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDFAVDYIKELE

Links
Other bHLH family TFs
Other *Solanum tuberosum* TFs

Invalid Input OrderBy

89 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action