TF Information

Hsal_02552--XP_001121050.1_APIME *(Harpegnathos saltator)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Hsal_02552--XP_001121050.1_APIME	T047379_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
dimm M03613_2.00	Drosophila melanogaster	BDCCATATGGHV	BDCCATATGGHV	SELEX Nitta et al.(2015) dimm_1	0.902	0.885
dimm M03614_2.00	Drosophila melanogaster	BACCATATGGTV	BACCATATGGTV	SELEX Nitta et al.(2015) dimm_2	0.902	0.885
dimm M05976_2.00	Drosophila melanogaster	HCCATATGGYG	CRCCATATGGD	B1H Zhu et al.(2011) dimm_da_SANGER_5_FBgn0023091	0.902	0.885
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Hsal_02552--XP_001121050.1_APIME	bHLH	85	137	RRLESNERERMRMHSLNDAFEQLREVIPHVKMERKLSKIETLTLAKNYIMALT

Links
Other bHLH family TFs
Other *Harpegnathos saltator* TFs

Invalid Input OrderBy

70 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action