TF Information

estExt_fgenesh1_pg.C_2110039 *(Physcomitrella patens)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	estExt_fgenesh1_pg.C_2110039	T048329_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
fgenesh1_pg.scaffold_37000071 M01757_2.00	Physcomitrella patens	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8584	0.914	1.000
BIM1 M01710_2.00	Arabidopsis thaliana	NCRCGTGNNN	NNNCACGYGN	PBM Weirauch et al.(2014) pTH8114	0.882	0.922
BIM1 M06739_2.00	Arabidopsis thaliana	CACGTGAYNHNNNH	DNNNDNRTCACGTG	Dap-seq OMalley et al.(2016) BIM1_col_a	0.882	0.922
BIM1 M06740_2.00	Arabidopsis thaliana	NVKCACGTGMYHHNHNHNHNNN	NNNDNDNDNDDRKCACGTGMBN	Dap-seq OMalley et al.(2016) BIM1_colamp_a	0.882	0.922
BIM1 M09787_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BIM1_01	0.882	0.922
BIM2 M01701_2.00	Arabidopsis thaliana	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8089	0.861	0.765
BIM2 M06727_2.00	Arabidopsis thaliana	CACGTGHBNNNNNNNNNNN	NNNNNNNNNNNVDCACGTG	Dap-seq OMalley et al.(2016) BIM2_colamp	0.861	0.765
BIM2 M06728_2.00	Arabidopsis thaliana	CACGTGMBNNNCVYV	BRBGNNNVKCACGTG	Dap-seq OMalley et al.(2016) BIM2_col_v3b	0.861	0.765
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
estExt_fgenesh1_pg.C_2110039	bHLH	444	494	PRSKHSATEQRRRSKINDRFQMLRDLVPHSDQKRDKASFLLEVIEYIQVLQ

Links
Other bHLH family TFs
Other *Physcomitrella patens* TFs

Invalid Input OrderBy

165 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action