TF Information

Lus10019247.g *(Linum usitatissimum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Lus10019247.g	T050209_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT2G22750 M06730_2.00	Arabidopsis thaliana	MRYGTKDNHCACGTGNN	NNCACGTGDNHMACRYK	Dap-seq OMalley et al.(2016) bHLH18_col_a	0.881	0.776
OS01G0235700 M09894_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BHLH66_01	0.849	0.612
PK09702.1 M01124_2.00	Cannabis sativa	GCACGTGV	BCACGTGC	PBM Lambert et al.(2019) pTH11374	0.845	0.612
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Lus10019247	bHLH	165	213	AQDHVMAERNRREKLSERFIALSAVIPGLKKTDKASVLGDAIKYLKQLQ

Links
Other bHLH family TFs
Other *Linum usitatissimum* TFs

Invalid Input OrderBy

470 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action