TF Information

Pavir.Ab03239 *(Panicum virgatum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Pavir.Ab03239	T050671_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SPT M01709_2.00	Arabidopsis thaliana	NCACGTGSN	NSCACGTGN	PBM Weirauch et al.(2014) pTH8111	0.891	0.920
e_gw1.209.40.1 M01756_2.00	Physcomitrella patens	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8070	0.866	0.620
LRL2 M06738_2.00	Arabidopsis thaliana	CACGTGSVDMNCACG	CGTGNKHBSCACGTG	Dap-seq OMalley et al.(2016) bHLH69_col_a	0.866	0.580
PK05451.1 M01120_2.00	Cannabis sativa	YCACGTGM	KCACGTGR	PBM Lambert et al.(2019) pTH10100	0.854	0.800
PIF3 M00854_2.00	Arabidopsis thaliana	CACGTGSNN	NNSCACGTG	PBM Franco-Zorrilla et al.(2014) PIF3	0.854	0.780
PIF3 M00722_2.00	Arabidopsis thaliana	NCACRTN	NAYGTGN	PBM Chang et al.(2013) pTH8200	0.854	0.780
PIF3 M08045_2.00	Arabidopsis thaliana	HCACGTGGVH	DBCCACGTGD	ChIP-seq Mathelier et al.(2014) MA0560.1	0.854	0.780
PIF3 M09780_2.00	Arabidopsis thaliana	BDRRRVCACGTGRVSHCD	HGDSBYCACGTGBYYYHV	Transfac Matys et al.(2006) P$PIF3_01	0.854	0.780
PIF3 M09781_2.00	Arabidopsis thaliana	DDDVCCACGTGGVMVNB	VNBKBCCACGTGGBHHH	Transfac Matys et al.(2006) P$PIF3_02	0.854	0.780
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pavir.Ab03239.1.p	bHLH	47	96	AAEVHNLSEKRRRSRINEKMKALQTLVPNSSKTDKASMLDDAIEYLKQLQ
Pavir.Ab03239.2.p	bHLH	47	96	AAEVHNLSEKRRRSRINEKMKALQTLVPNSSKTDKASMLDDAIEYLKQLQ

Links
Other bHLH family TFs
Other *Panicum virgatum* TFs

Invalid Input OrderBy

362 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action