TF Information

Thhalv10027582m.g *(Eutrema salsugineum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Thhalv10027582m.g	T051297_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PIF1 M01703_2.00	Arabidopsis thaliana	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8733	0.866	0.860
PIF1 M08404_2.00	Arabidopsis thaliana	NCACGTGWSNYNHH	DDNRNSWCACGTGN	ChIP-chip Mathelier et al.(2014) MA0552.1	0.866	0.860
PIF1 M09783_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PIF1_01	0.866	0.860
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10027582m	bHLH	289	338	AAEMHNLSERKRRGRINERMKALQELVPRSNKSDKASMLEDAIEYVKSLQ

Links
Other bHLH family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

62 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action