TF Information

Kwal_6961 *(Kluyveromyces waltii)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Kwal_6961	T052132_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TYE7 M00011_2.00	Saccharomyces cerevisiae	VTCACGTG	CACGTGAB	PBM Badis et al.(2008) TYE7_2097	0.861	0.909
TYE7 M01521_2.00	Saccharomyces cerevisiae	NRYCASSTGD	HCASSTGRYN	PBM Zhu et al.(2009) Tye7	0.861	0.909
TYE7 M07441_2.00	Saccharomyces cerevisiae	TCACGTG	CACGTGA	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0409.1	0.861	0.909
TYE7 M08489_2.00	Saccharomyces cerevisiae	RTCACGTGA	TCACGTGAY	Misc DeBoer et al.(2011) YOR344C_397	0.861	0.909
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Kwal_6961	bHLH	263	340	QKQAHNKIEKRYRININTKIAKLQQIIPWVASEETAFEVGDSSRGNLRAAADAVATATPKLNKSMILEKAVDYILYLQ

Links
Other bHLH family TFs
Other *Kluyveromyces waltii* TFs

Invalid Input OrderBy

12 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action