TF Information

Bra039631 *(Brassica rapa)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Bra039631	T057533_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BZIP53 M06779_2.00	Arabidopsis thaliana	DNWGMTGACGTGKCV	BGMCACGTCAKCWNH	Dap-seq OMalley et al.(2016) bZIP53_colamp_a	0.789	0.532
BZIP53 M06780_2.00	Arabidopsis thaliana	DDWGMTGACGTGGMV	BKCCACGTCAKCWHH	Dap-seq OMalley et al.(2016) bZIP53_col	0.789	0.532
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra039631.1-P	bZIP	27	88	DERKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILTSLPVTSELYMKIQAENS

Links
Other bZIP family TFs
Other *Brassica rapa* TFs

Invalid Input OrderBy

89 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action