TF Information

Cebpa *(Mus musculus)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	ENSMUSG00000034957	T060479_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. The use of alternative in-frame non-AUG (CUG) and AUG start codons results in several protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the CUG and the first AUG start codons. [provided by RefSeq, Sep 2014]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Cebpa M00993_2.00	Mus musculus	NTTDCGCAA	TTGCGHAAN	PBM Mann et al.(2013) CEBPA_M_HK	(Direct)	(Direct)
Cebpa M00994_2.00	Mus musculus	TTDCGCAA	TTGCGHAA	PBM Mann et al.(2013) CEBPA_UM_HK	(Direct)	(Direct)
Cebpa M01811_2.00	Mus musculus	VTKDYRHMAB	VTKDYRHMAB	PBM Weirauch et al.(2014) pTH5166	(Direct)	(Direct)
Cebpa M08830_2.00	Mus musculus	DVTKDNGCAAB	VTTGCNHMABH	Misc Kulakovskiy et al.(2013) CEBPA_MOUSE.H11MO.0.A	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CEBPA M04045_2.00	Homo sapiens	NVTKRCGCAABN	NVTTGCGYMABN	SELEX Rodriguez-Martinez et al.(2017) CEBPA.1	0.883	1.000
CEBPA M08076_2.00	Homo sapiens	DRTTDTGCAAY	RTTGCAHAAYH	ChIP-seq Mathelier et al.(2014) MA0102.3	0.883	1.000
CEBPA M08813_2.00	Homo sapiens	NVTKKWGCAABN	NVTTGCWMMABN	Misc Kulakovskiy et al.(2013) CEBPA_HUMAN.H11MO.0.A	0.883	1.000
CEBPA M10023_2.00	Homo sapiens	NNNWHWVCAMWBN	NVWKTGBWDWNNN	Transfac Matys et al.(2006) V$CEBP_01	0.883	1.000
CEBPA M10024_2.00	Homo sapiens	NNNTKDNSYAAHNN	NNDTTRSNHMANNN	Transfac Matys et al.(2006) V$CEBPA_01	0.883	1.000
CEBPA M10025_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPA_04	0.883	1.000
CEBPA M10026_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPA_Q4	0.883	1.000
CEBPA M10027_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPA_Q6	0.883	1.000
CEBPA M10028_2.00	Homo sapiens	NGWVTKHBGYAAKVBAYD	HRTVBMTTRCVDMABWCN	Transfac Matys et al.(2006) V$CEBP_C	0.883	1.000
CEBPA M10029_2.00	Homo sapiens	NNNTKDHSCAANNN	NNNTTGSDHMANNN	Transfac Matys et al.(2006) V$CEBP_Q2	0.883	1.000
Cebpb M02636_2.00	Mus musculus	VTKDYGYAAB	VTTRCRHMAB	PBM Tillo et al.(2017) CEBPB_C	0.844	0.763
Cebpb M00999_2.00	Mus musculus	VTKDYGYAAB	VTTRCRHMAB	PBM Mann et al.(2013) CEBPB_UM_HK	0.844	0.763
Cebpb M00761_2.00	Mus musculus	NTKDHGHAAB	VTTDCDHMAN	PBM Weirauch et al.(2013) pTH3208	0.844	0.763
Cebpb M01818_2.00	Mus musculus	VTKDYGYAAB	VTTRCRHMAB	PBM Weirauch et al.(2014) pTH5460	0.844	0.763
CEBPB M02851_2.00	Homo sapiens	VTTRCGCAAY	RTTGCGYAAB	SELEX Jolma et al.(2013) CEBPB_1	0.844	0.763
CEBPB M02852_2.00	Homo sapiens	VTTRCGCAAY	RTTGCGYAAB	SELEX Jolma et al.(2013) CEBPB_2	0.844	0.763
Cebpb M02867_2.00	Mus musculus	VTTRCGCAAY	RTTGCGYAAB	SELEX Jolma et al.(2013) Cebpb_1	0.844	0.763
CEBPB M04331_2.00	Homo sapiens	NVTTRCGCAAYN	NRTTGCGYAABN	SELEX Yin et al.(2017) CEBPB_eDBD_HT-SELEX	0.844	0.763
CEBPB M05840_2.00	Homo sapiens	RTTRCGYAAYM	KRTTRCGYAAY	SMiLE-seq Isakova et al.(2017) CEBPb	0.844	0.763
CEBPB M07830_2.00	Homo sapiens	NNDRTKDYGCAAYN	NRTTGCRHMAYHNN	ChIP-seq Gerstein et al.(2012) HeLa-S3_CEBPB_Stanford	0.844	0.763
CEBPB M07831_2.00	Homo sapiens	RTKRYGCAAYV	BRTTGCRYMAY	ChIP-seq Gerstein et al.(2012) HepG2_CEBPB_Stanford	0.844	0.763
CEBPB M07832_2.00	Homo sapiens	DRTKRYGCAAYVNN	NNBRTTGCRYMAYH	ChIP-seq Gerstein et al.(2012) K562_CEBPB_Stanford	0.844	0.763
CEBPB M08804_2.00	Homo sapiens	DRTKDHGCAAYV	BRTTGCDHMAYH	Misc Kulakovskiy et al.(2013) CEBPB_HUMAN.H11MO.0.A	0.844	0.763
Cebpb M08841_2.00	Mus musculus	DRTKDHGCAAB	VTTGCDHMAYH	Misc Kulakovskiy et al.(2013) CEBPB_MOUSE.H11MO.0.A	0.844	0.763
Cebpb M09498_2.00	Mus musculus	GTTGYRCAAT	ATTGYRCAAC	Misc Heinz et al.(2010) ThioMac-CEBPb_GSE21512	0.844	0.763
CEBPB M09993_2.00	Homo sapiens	RNRTKDDGHAAKNN	NNMTTDCHHMAYNY	Transfac Matys et al.(2006) V$CEBPB_01	0.844	0.763
CEBPB M09994_2.00	Homo sapiens	NDRTKDHGCAABMH	DKVTTGCDHMAYHN	Transfac Matys et al.(2006) V$CEBPB_02	0.844	0.763
CEBPB M09995_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPB_04	0.844	0.763
CEBPB M09996_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPB_07	0.844	0.763
CEBPB M09997_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPB_Q3	0.844	0.763
CEBPB M09998_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPB_Q6	0.844	0.763
Cebpb M02633_2.00	Mus musculus	VTKDNGHAAB	VTTDCNHMAB	PBM Tillo et al.(2017) CEBPB_5hmC	0.844	0.763
Cebpb M02634_2.00	Mus musculus	TKDYGYAAYN	NRTTRCRHMA	PBM Tillo et al.(2017) CEBPB_5mCG	0.844	0.763
Cebpb M02635_2.00	Mus musculus	YKDYGHAAYN	NRTTDCRHMR	PBM Tillo et al.(2017) CEBPB_5mC	0.844	0.763
Cebpb M00998_2.00	Mus musculus	NTTDCGCAA	TTGCGHAAN	PBM Mann et al.(2013) CEBPB_M_HK	0.844	0.763
CEBPB M04332_2.00	Homo sapiens	NRTTRCGCAAYN	NRTTGCGYAAYN	SELEX Yin et al.(2017) CEBPB_eDBD_Methyl-HT-SELEX	0.844	0.763
CEBPE M02824_2.00	Homo sapiens	VTTRCGCAAY	RTTGCGYAAB	SELEX Jolma et al.(2013) CEBPE_1	0.793	0.763
CEBPE M02729_2.00	Homo sapiens	VTTDYRHAAY	RTTDYRHAAB	SELEX Jolma et al.(2010) CEBPE_dimer	0.793	0.763
CEBPE M04227_2.00	Homo sapiens	NRTTRCGCAAYN	NRTTGCGYAAYN	SELEX Yin et al.(2017) CEBPE_eDBD_HT-SELEX	0.793	0.763
CEBPE M04009_2.00	Homo sapiens	NVTKRYRCAABN	NVTTGYRYMABN	SELEX Rodriguez-Martinez et al.(2017) CEBPE.1	0.793	0.763
CEBPE M08783_2.00	Homo sapiens	VHDATTDCVHAM	KTDBGHAATHDB	Misc Kulakovskiy et al.(2013) CEBPE_HUMAN.H11MO.0.A	0.793	0.763
CEBPE M09927_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPE_01	0.793	0.763
CEBPE M09928_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPE_Q6_01	0.793	0.763
CEBPE M09929_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CEBPE_Q6	0.793	0.763
CEBPE M04228_2.00	Homo sapiens	NRTTRCGCAAYN	NRTTGCGYAAYN	SELEX Yin et al.(2017) CEBPE_eDBD_Methyl-HT-SELEX	0.793	0.763
Cebpe M01815_2.00	Mus musculus	TKDYGCAA	TTGCRHMA	PBM Weirauch et al.(2014) pTH5253	0.792	0.746
Cebpe M08836_2.00	Mus musculus	VHDATTDCVHAM	KTDBGHAATHDB	Misc Kulakovskiy et al.(2013) CEBPE_MOUSE.H11MO.0.A	0.792	0.746
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

Experimental Constructs

Motif ID	Domain	From	To	Sequence
M00993_2.00	bZIP	20	78	YRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFR
M00994_2.00	bZIP	20	78	YRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFR
M01811_2.00	bZIP	20	78	YRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFR

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMUSP00000096129	bZIP	286	344	YRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFR

Links
Other bZIP family TFs
Other *Mus musculus* TFs

Invalid Input OrderBy

131 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Cebpa (Mus musculus) bZIP

TF Information

Directly determined binding motifs

Motifs from related TFs

Experimental Constructs

DNA Binding Domains

Links

131 Related TFs

Invalid Input OrderBy

Cebpa **(Mus musculus)
bZIP**