TF Information

ENSSSCG00000022482 *(Sus scrofa)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	ENSSSCG00000022482	T061437_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DDIT3 M09999_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CHOP10_01	0.978	0.968
Ddit3 M08822_2.00	Mus musculus	MTGATGHAAB	VTTDCATCAK	Misc Kulakovskiy et al.(2013) DDIT3_MOUSE.H11MO.0.C	0.867	0.889
Ddit3 M09492_2.00	Mus musculus	MTGATGHAAB	VTTDCATCAK	Misc Heinz et al.(2010) MEF-Chop_GSE35681	0.867	0.889
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSSSCP00000022016	bZIP	94	157	EEDQRRPRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRAL

Links
Other bZIP family TFs
Other *Sus scrofa* TFs

Invalid Input OrderBy

28 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action