TF Information

GSMUA_Achr10G01440_001 *(Musa acuminata)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	GSMUA_Achr10G01440_001	T063209_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BZIP17 M01778_2.00	Arabidopsis thaliana	NNHBACGYRN	NYRCGTVDNN	PBM Weirauch et al.(2014) pTH7221	0.804	0.797
TGA1B_TOBAC M10083_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1B_01	0.786	0.656
TGA1B_TOBAC M10084_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1B_Q2	0.786	0.656
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr10P01440_001	bZIP	153	216	EEDDRRKTRLIRNRESAQLSRQRKKQYVEELEEKVRAMHSTINELNAKISYFMAENVSLRQQLG

Links
Other bZIP family TFs
Other *Musa acuminata* TFs

Invalid Input OrderBy

91 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action