TF Information

GSMUA_Achr9G14690_001 *(Musa acuminata)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	GSMUA_Achr9G14690_001	T063335_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OS02G0728001 M01826_2.00	Oryza sativa	NHCACGTGKNN	NNMCACGTGDN	PBM Weirauch et al.(2014) pTH8334	0.815	0.794
OS02G0728001 M01827_2.00	Oryza sativa	WSACGTGG	CCACGTSW	PBM Weirauch et al.(2014) pTH8737	0.815	0.794
ATBZIP42 M06775_2.00	Arabidopsis thaliana	TGCTGACGTGGM	KCCACGTCAGCA	Dap-seq OMalley et al.(2016) bZIP42_col_a	0.809	0.603
ATBZIP42 M06776_2.00	Arabidopsis thaliana	TGCTGACGTGGCV	BGCCACGTCAGCA	Dap-seq OMalley et al.(2016) bZIP42_colamp_a	0.809	0.603
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr9P14690_001	bZIP	64	126	AEERRKRRMISNRESARRSRMRKQKHFSELWTQVVHLRSANRQLLDELNRVMRERDRIMHEND

Links
Other bZIP family TFs
Other *Musa acuminata* TFs

Invalid Input OrderBy

128 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action