CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

LPERR07G23230 *(Leersia perrieri)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	LPERR07G23230	T064186_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK00315.1 M01153_2.00	Cannabis sativa	NNGACAGCTRN	NYAGCTGTCNN	PBM Lambert et al.(2019) pTH10085	0.789	1.000
PK16335.1 M01157_2.00	Cannabis sativa	NNNNKACAGCTRN	NYAGCTGTMNNNN	PBM Lambert et al.(2019) pTH10187	0.789	0.982
AtbZIP52 M06746_2.00	Arabidopsis thaliana	DTGMCAGCYBDNHH	DDNHVRGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP52_colamp_a	0.789	0.930
AtbZIP52 M06747_2.00	Arabidopsis thaliana	DTGMCAGCYKDNHN	NDNHMRGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP52_col_v31	0.789	0.930
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
LPERR07G23230.1	bZIP	170	226	DPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTGL

Links
Other bZIP family TFs
Other *Leersia perrieri* TFs