TF Information

PRUPE_ppa007578mg *(Prunus persica)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	PRUPE_ppa007578mg	T067077_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TGA1A M02662_2.00	Nicotiana sp.	TGACGTD	HACGTCA	SELEX Mathelier et al.(2014) MA0129.1	0.784	0.820
TGA1A_TOBAC M10081_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1A_Q2_01	0.784	0.820
TGA1A_TOBAC M10082_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1A_Q2	0.784	0.820
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMJ06605	bZIP	74	123	KPTDKVQRRLAQNREAARKSRMRKKAYVQQLETSRLKLIQLEQELDRARQ

Links
Other bZIP family TFs
Other *Prunus persica* TFs

Invalid Input OrderBy

16 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action