TF Information

Solyc10g080770.1 *(Solanum lycopersicum)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Solyc10g080770.1	T068242_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TGA9 M01053_2.00	Arabidopsis thaliana	NNNMTGACGTHN	NDACGTCAKNNN	PBM Sullivan et al.(2014) pTH9788	0.788	0.683
TGA9 M06748_2.00	Arabidopsis thaliana	RTGACGTCAKC	GMTGACGTCAY	Dap-seq OMalley et al.(2016) TGA9_col_a	0.788	0.683
TGA9 M06749_2.00	Arabidopsis thaliana	TKACGTCAKCD	HGMTGACGTMA	Dap-seq OMalley et al.(2016) TGA9_colamp_a	0.788	0.683
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc10g080770.1.1	bZIP	162	221	DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLSQLEQDLQRARQQGKYISNMADQS

Links
Other bZIP family TFs
Other *Solanum lycopersicum* TFs

Invalid Input OrderBy

77 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action