TF Information

tetur01g00200 *(Tetranychus urticae)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	tetur01g00200	T068510_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Atf2 M01808_2.00	Mus musculus	NRTKAYGYMD	HKRCRTMAYN	PBM Weirauch et al.(2014) pTH5083	0.806	0.516
Atf2 M08827_2.00	Mus musculus	VTGACVTCABY	RVTGABGTCAB	Misc Kulakovskiy et al.(2013) ATF2_MOUSE.H11MO.0.A	0.806	0.516
Atf2 M09493_2.00	Mus musculus	NNVTGABVTCAB	VTGABVTCABNN	Misc Heinz et al.(2010) 3T3L1-Atf2_GSE56872	0.806	0.516
Atf7 M01823_2.00	Mus musculus	HKACGTMAYN	NRTKACGTMD	PBM Weirauch et al.(2014) pTH5081	0.790	0.516
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
tetur01g00200.1	bZIP	102	165	DPRQKKVRSLERNRAAAMRCREKRKLAIKALEANADEMQKLNDRLQGEVAILRKKVTELKTALL

Links
Other bZIP family TFs
Other *Tetranychus urticae* TFs

Invalid Input OrderBy

105 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action