TF Information

VIT_08s0040g00870 *(Vitis vinifera)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	VIT_08s0040g00870	T069333_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BZIP17 M01778_2.00	Arabidopsis thaliana	NNHBACGYRN	NYRCGTVDNN	PBM Weirauch et al.(2014) pTH7221	0.880	0.825
TGA1B_TOBAC M10083_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1B_01	0.838	0.746
TGA1B_TOBAC M10084_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1B_Q2	0.838	0.746
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
VIT_08s0040g00870.t01	bZIP	271	333	DEEEKKKARLMRNRESAQLSRQRKKHYVEELEEKIRSMHSTIQDLTGKISIIMAENANLRQQF

Links
Other bZIP family TFs
Other *Vitis vinifera* TFs

Invalid Input OrderBy

69 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action