TF Information

Carubv10003520m.g *(Capsella rubella)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	Carubv10003520m.g	T071547_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HY5 M06790_2.00	Arabidopsis thaliana	DNHGVTGACGTSDMN	NKHSACGTCABCDNH	Dap-seq OMalley et al.(2016) HY5_colamp_v3a	0.830	1.000
HY5 M08407_2.00	Arabidopsis thaliana	NNHGMCACGTGKCDNN	NNHGMCACGTGKCDNN	ChIP-chip Mathelier et al.(2014) MA0551.1	0.830	1.000
HY5 M09919_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$HY5_01	0.830	1.000
Q39895_SOYBN M10048_2.00	Glycine max	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$STF1_01	0.830	0.869
Q39895_SOYBN M10049_2.00	Glycine max	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$STF1_02	0.830	0.869
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10003520m	bZIP	86	146	EKENKRLKRLLRNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLRH

Links
Other bZIP family TFs
Other *Capsella rubella* TFs

Invalid Input OrderBy

93 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action