ZFP28 (Callithrix jacchus)
C2H2 ZF

TF Information

Pfam ID Interpro ID Gene ID CIS-BP ID Sequence source Animal TF db
PF00096 (zf-C2H2) IPR007087 ENSCJAG00000020297 T089658_2.00 Ensembl (2018-Dec-8) Link out

Directly determined binding motifs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
No direct experiments

Motifs from related TFs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
ZFP28
M08378_2.00
Homo sapiens
DNNHNNHNHDDBMKYTCHDTTTCYTYWDNK

NAYMNHWRARGAAAHDGARMKVHHDNDNND
ChIP-seq
Schmitges et al.(2016)
Q8NHY6_2-12.RCADE
0.767 0.938
ZFP28
M08949_2.00
Homo sapiens
YTCTRTTTCTTCTKRWGTCA

TGACWYMAGAAGAAAYAGAR
Misc
Kulakovskiy et al.(2013)
ZFP28_HUMAN.H11MO.0.C
0.767 0.938
For this family, TFs with SR scores > 0.755 will likely have a similar motif

DNA Binding Domains

Protein ID Domain From To Sequence
ENSCJAP00000037734 C2H2 ZF 420 442
ENSCJAP00000037734 C2H2 ZF 448 470
ENSCJAP00000037734 C2H2 ZF 476 499
ENSCJAP00000037734 C2H2 ZF 505 527
ENSCJAP00000037734 C2H2 ZF 533 555
ENSCJAP00000037734 C2H2 ZF 561 583
ENSCJAP00000037734 C2H2 ZF 589 611
ENSCJAP00000037734 C2H2 ZF 617 639
ENSCJAP00000037734 C2H2 ZF 645 667
ENSCJAP00000037734 C2H2 ZF 673 695
ENSCJAP00000037734 C2H2 ZF 701 723
ENSCJAP00000037734 C2H2 ZF 729 751
ENSCJAP00000037734 C2H2 ZF 757 779
ENSCJAP00000037734 C2H2 ZF 785 807

Links

Other C2H2 ZF family TFs
Other Callithrix jacchus TFs

23 Related TFs

Name Species Gene ID Motif Evidence SR
Score
Action
ZFP28 Sus scrofa ENSSSCG00000027774 I 0.823
ZFP28 Equus caballus ENSECAG00000013849 I 0.822
ENSMPUG00000006646 Mustela putorius furo ENSMPUG00000006646 I 0.820
ZFP28 Canis familiaris ENSCAFG00000024289 I 0.819
ZFP28 Loxodonta africana ENSLAFG00000010041 I 0.819
ZFP28 Dasypus novemcinctus ENSDNOG00000007010 I 0.816
ENSSTOG00000022134 Ictidomys tridecemlineatus ENSSTOG00000022134 I 0.813
Zfp28 Rattus norvegicus ENSRNOG00000042777 I 0.811
Zfp28 Mus musculus ENSMUSG00000062861 N 0.811
ZFP28 Echinops telfairi ENSETEG00000002303 I 0.810
ZFP28 Ochotona princeps ENSOPRG00000014306 I 0.810
ENSBTAP00000021794-D1 Bos grunniens ENSBTAP00000021794-D1 N 0.797
ZFP28 Bos taurus ENSBTAG00000002055 N 0.797
ZFP28 Homo sapiens ENSG00000196867 D 0.767
ENSP00000301318 Macaca fascicularis ENSP00000301318 I 0.767
ZFP28 Pan troglodytes ENSPTRG00000023421 I 0.767
ENSCSAG00000001666 Chlorocebus sabaeus ENSCSAG00000001666 I 0.767
ENSPANG00000008416 Papio anubis ENSPANG00000008416 I 0.767
ZFP28 Gorilla gorilla ENSGGOG00000011352 I 0.767
ZFP28 Macaca mulatta ENSMMUG00000021673 I 0.767
ENSNLEG00000010865 Nomascus leucogenys ENSNLEG00000010865 I 0.766
ENSPPYG00000010451 Pongo abelii ENSPPYG00000010451 I 0.766
ZFP28 Otolemur garnettii ENSOGAG00000004896 I 0.764