ZFP28 (Dasypus novemcinctus)
C2H2 ZF

TF Information

Pfam ID Interpro ID Gene ID CIS-BP ID Sequence source Animal TF db
PF00096 (zf-C2H2) IPR007087 ENSDNOG00000007010 T092104_2.00 Ensembl (2018-Dec-8) Link out

Directly determined binding motifs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
No direct experiments

Motifs from related TFs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
ZFP28
M08378_2.00
Homo sapiens
DNNHNNHNHDDBMKYTCHDTTTCYTYWDNK

NAYMNHWRARGAAAHDGARMKVHHDNDNND
ChIP-seq
Schmitges et al.(2016)
Q8NHY6_2-12.RCADE
0.763 0.926
ZFP28
M08949_2.00
Homo sapiens
YTCTRTTTCTTCTKRWGTCA

TGACWYMAGAAGAAAYAGAR
Misc
Kulakovskiy et al.(2013)
ZFP28_HUMAN.H11MO.0.C
0.763 0.926
For this family, TFs with SR scores > 0.755 will likely have a similar motif

DNA Binding Domains

Protein ID Domain From To Sequence
ENSDNOP00000030290 C2H2 ZF 429 451
ENSDNOP00000030290 C2H2 ZF 457 479
ENSDNOP00000030290 C2H2 ZF 485 508
ENSDNOP00000030290 C2H2 ZF 514 536
ENSDNOP00000030290 C2H2 ZF 545 564
ENSDNOP00000030290 C2H2 ZF 570 592
ENSDNOP00000030290 C2H2 ZF 598 620
ENSDNOP00000030290 C2H2 ZF 626 648
ENSDNOP00000030290 C2H2 ZF 654 676
ENSDNOP00000030290 C2H2 ZF 682 704
ENSDNOP00000030290 C2H2 ZF 710 732
ENSDNOP00000030290 C2H2 ZF 738 760
ENSDNOP00000030290 C2H2 ZF 766 788
ENSDNOP00000030290 C2H2 ZF 794 816

Links

Other C2H2 ZF family TFs
Other Dasypus novemcinctus TFs

23 Related TFs

Name Species Gene ID Motif Evidence SR
Score
Action
ENSBTAP00000021794-D1 Bos grunniens ENSBTAP00000021794-D1 N 0.787
ENSCSAG00000001666 Chlorocebus sabaeus ENSCSAG00000001666 I 0.765
ENSMPUG00000006646 Mustela putorius furo ENSMPUG00000006646 I 0.817
ENSNLEG00000010865 Nomascus leucogenys ENSNLEG00000010865 I 0.762
ENSP00000301318 Macaca fascicularis ENSP00000301318 I 0.765
ENSPANG00000008416 Papio anubis ENSPANG00000008416 I 0.765
ENSPPYG00000010451 Pongo abelii ENSPPYG00000010451 I 0.762
ENSSTOG00000022134 Ictidomys tridecemlineatus ENSSTOG00000022134 I 0.813
Zfp28 Rattus norvegicus ENSRNOG00000042777 I 0.811
ZFP28 Sus scrofa ENSSSCG00000027774 I 0.819
ZFP28 Ochotona princeps ENSOPRG00000014306 I 0.810
ZFP28 Otolemur garnettii ENSOGAG00000004896 I 0.760
ZFP28 Pan troglodytes ENSPTRG00000023421 I 0.763
Zfp28 Mus musculus ENSMUSG00000062861 N 0.807
ZFP28 Canis familiaris ENSCAFG00000024289 I 0.816
ZFP28 Callithrix jacchus ENSCJAG00000020297 I 0.816
ZFP28 Equus caballus ENSECAG00000013849 I 0.820
ZFP28 Echinops telfairi ENSETEG00000002303 I 0.812
ZFP28 Homo sapiens ENSG00000196867 D 0.763
ZFP28 Gorilla gorilla ENSGGOG00000011352 I 0.763
ZFP28 Loxodonta africana ENSLAFG00000010041 I 0.819
ZFP28 Macaca mulatta ENSMMUG00000021673 I 0.765
ZFP28 Bos taurus ENSBTAG00000002055 N 0.787