ZFP28 (Homo sapiens)
C2H2 ZF

TF Information

Pfam ID Interpro ID Gene ID CIS-BP ID Sequence source Animal TF db
PF00096 (zf-C2H2) IPR007087 ENSG00000196867 T095321_2.00 Ensembl (2018-Dec-8) Link out

Directly determined binding motifs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
ZFP28
M08378_2.00
Homo sapiens
DNNHNNHNHDDBMKYTCHDTTTCYTYWDNK

NAYMNHWRARGAAAHDGARMKVHHDNDNND
ChIP-seq
Schmitges et al.(2016)
Q8NHY6_2-12.RCADE
(Direct) (Direct)
ZFP28
M08949_2.00
Homo sapiens
YTCTRTTTCTTCTKRWGTCA

TGACWYMAGAAGAAAYAGAR
Misc
Kulakovskiy et al.(2013)
ZFP28_HUMAN.H11MO.0.C
(Direct) (Direct)

Motifs from related TFs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
For this family, TFs with SR scores > 0.755 will likely have a similar motif

DNA Binding Domains

Protein ID Domain From To Sequence
ENSP00000301318 C2H2 ZF 420 442
ENSP00000301318 C2H2 ZF 448 470
ENSP00000301318 C2H2 ZF 476 499
ENSP00000301318 C2H2 ZF 505 527
ENSP00000301318 C2H2 ZF 533 555
ENSP00000301318 C2H2 ZF 561 583
ENSP00000301318 C2H2 ZF 589 611
ENSP00000301318 C2H2 ZF 617 639
ENSP00000301318 C2H2 ZF 645 667
ENSP00000301318 C2H2 ZF 673 695
ENSP00000301318 C2H2 ZF 701 723
ENSP00000301318 C2H2 ZF 729 751
ENSP00000301318 C2H2 ZF 757 779
ENSP00000301318 C2H2 ZF 785 807
ENSP00000301318 C2H2 ZF 819 835

Links

Other C2H2 ZF family TFs
Other Homo sapiens TFs

20 Related TFs

Name Species Gene ID Motif Evidence SR
Score
Action
ZFP28 Callithrix jacchus ENSCJAG00000020297 I 0.767
ZFP28 Canis familiaris ENSCAFG00000024289 I 0.766
ENSCSAG00000001666 Chlorocebus sabaeus ENSCSAG00000001666 I 0.825
ZFP28 Dasypus novemcinctus ENSDNOG00000007010 I 0.763
ZFP28 Echinops telfairi ENSETEG00000002303 I 0.759
ZFP28 Equus caballus ENSECAG00000013849 I 0.768
ZFP28 Gorilla gorilla ENSGGOG00000011352 I 0.827
ENSSTOG00000022134 Ictidomys tridecemlineatus ENSSTOG00000022134 I 0.760
ZFP28 Loxodonta africana ENSLAFG00000010041 I 0.763
ENSP00000301318 Macaca fascicularis ENSP00000301318 I 0.825
ZFP28 Macaca mulatta ENSMMUG00000021673 I 0.825
ENSMPUG00000006646 Mustela putorius furo ENSMPUG00000006646 I 0.766
ENSNLEG00000010865 Nomascus leucogenys ENSNLEG00000010865 I 0.826
ZFP28 Ochotona princeps ENSOPRG00000014306 I 0.759
ZFP28 Otolemur garnettii ENSOGAG00000004896 I 0.821
ZFP28 Pan troglodytes ENSPTRG00000023421 I 0.827
ENSPANG00000008416 Papio anubis ENSPANG00000008416 I 0.825
ENSPPYG00000010451 Pongo abelii ENSPPYG00000010451 I 0.826
Zfp28 Rattus norvegicus ENSRNOG00000042777 I 0.758
ZFP28 Sus scrofa ENSSSCG00000027774 I 0.769