ENSP00000301318 (Macaca fascicularis)
C2H2 ZF

TF Information

Pfam ID Interpro ID Gene ID CIS-BP ID Sequence source
PF00096 (zf-C2H2) IPR007087 ENSP00000301318 T135021_2.00 GigaDB (2015-Oct-22)

Directly determined binding motifs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
No direct experiments

Motifs from related TFs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
ZFP28
M08378_2.00
Homo sapiens
DNNHNNHNHDDBMKYTCHDTTTCYTYWDNK

NAYMNHWRARGAAAHDGARMKVHHDNDNND
ChIP-seq
Schmitges et al.(2016)
Q8NHY6_2-12.RCADE
0.825 0.991
ZFP28
M08949_2.00
Homo sapiens
YTCTRTTTCTTCTKRWGTCA

TGACWYMAGAAGAAAYAGAR
Misc
Kulakovskiy et al.(2013)
ZFP28_HUMAN.H11MO.0.C
0.825 0.991
For this family, TFs with SR scores > 0.755 will likely have a similar motif

DNA Binding Domains

Protein ID Domain From To Sequence
ENSP00000301318 C2H2 ZF 385 407
ENSP00000301318 C2H2 ZF 413 435
ENSP00000301318 C2H2 ZF 441 464
ENSP00000301318 C2H2 ZF 470 492
ENSP00000301318 C2H2 ZF 498 520
ENSP00000301318 C2H2 ZF 526 548
ENSP00000301318 C2H2 ZF 554 576
ENSP00000301318 C2H2 ZF 582 604
ENSP00000301318 C2H2 ZF 610 632
ENSP00000301318 C2H2 ZF 638 660
ENSP00000301318 C2H2 ZF 666 688
ENSP00000301318 C2H2 ZF 694 716
ENSP00000301318 C2H2 ZF 722 744
ENSP00000301318 C2H2 ZF 750 772
ENSP00000301318 C2H2 ZF 784 800

Links

Other C2H2 ZF family TFs
Other Macaca fascicularis TFs

21 Related TFs

Name Species Gene ID Motif Evidence SR
Score
Action
ENSPANG00000008416 Papio anubis ENSPANG00000008416 I 0.827
ENSCSAG00000001666 Chlorocebus sabaeus ENSCSAG00000001666 I 0.827
ZFP28 Macaca mulatta ENSMMUG00000021673 I 0.827
ZFP28 Gorilla gorilla ENSGGOG00000011352 I 0.825
ZFP28 Homo sapiens ENSG00000196867 D 0.825
ENSPPYG00000010451 Pongo abelii ENSPPYG00000010451 I 0.825
ENSNLEG00000010865 Nomascus leucogenys ENSNLEG00000010865 I 0.825
ZFP28 Pan troglodytes ENSPTRG00000023421 I 0.825
ZFP28 Otolemur garnettii ENSOGAG00000004896 I 0.822
ZFP28 Equus caballus ENSECAG00000013849 I 0.771
ZFP28 Sus scrofa ENSSSCG00000027774 I 0.770
ENSMPUG00000006646 Mustela putorius furo ENSMPUG00000006646 I 0.768
ZFP28 Callithrix jacchus ENSCJAG00000020297 I 0.767
ZFP28 Canis familiaris ENSCAFG00000024289 I 0.767
ZFP28 Loxodonta africana ENSLAFG00000010041 I 0.765
ZFP28 Dasypus novemcinctus ENSDNOG00000007010 I 0.765
ENSSTOG00000022134 Ictidomys tridecemlineatus ENSSTOG00000022134 I 0.761
Zfp28 Rattus norvegicus ENSRNOG00000042777 I 0.760
ZFP28 Echinops telfairi ENSETEG00000002303 I 0.759
ZFP28 Ochotona princeps ENSOPRG00000014306 I 0.758
Zfp28 Mus musculus ENSMUSG00000062861 N 0.756